Lineage for d2cf2l1 (2cf2 L:2001-2171)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 721376Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 721377Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families) (S)
  5. 721471Family d.38.1.2: beta-Hydroxydecanol thiol ester dehydrase [54641] (1 protein)
    contains two additional beta-strands in the N-terminal extension
  6. 721472Protein beta-Hydroxydecanol thiol ester dehydrase [54642] (1 species)
  7. 721473Species Escherichia coli [TaxId:562] [54643] (3 PDB entries)
  8. 721479Domain d2cf2l1: 2cf2 L:2001-2171 [130366]
    Other proteins in same PDB: d2cf2a1, d2cf2a2, d2cf2e1, d2cf2j1, d2cf2j2, d2cf2n1
    automatically matched to d1mkaa_

Details for d2cf2l1

PDB Entry: 2cf2 (more details)

PDB Description: architecture of mammalian fatty acid synthase
PDB Compounds: (L:) fatty acid synthase, dh domain

SCOP Domain Sequences for d2cf2l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cf2l1 d.38.1.2 (L:2001-2171) beta-Hydroxydecanol thiol ester dehydrase {Escherichia coli [TaxId: 562]}
vdkresytkedllasgrgelfgakgpqlpapnmlmmdrvvkmtetggnfdkgyveaeldi
npdlwffgchfigdpvmpgclgldamwqlvgfylgwlggegkgralgvgevkftgqvlpt
akkvtyrihfkrivnrrlimgladgevlvdgrliytasdlkvglfqdtsaf

SCOP Domain Coordinates for d2cf2l1:

Click to download the PDB-style file with coordinates for d2cf2l1.
(The format of our PDB-style files is described here.)

Timeline for d2cf2l1: