Lineage for d2cf2e1 (2cf2 E:2-239)

  1. Root: SCOPe 2.07
  2. 2647132Class i: Low resolution protein structures [58117] (25 folds)
  3. 2650229Fold i.26: Fatty acid synthase [144301] (1 superfamily)
  4. 2650230Superfamily i.26.1: Fatty acid synthase [144302] (1 family) (S)
  5. 2650231Family i.26.1.1: Fatty acid syntase [144303] (2 proteins)
  6. 2650235Protein mammalian fatty acid synthase [144304] (1 species)
  7. 2650236Species Pig (Sus scrofa) [TaxId:9823] [144305] (1 PDB entry)
  8. 2650237Domain d2cf2e1: 2cf2 E:2-239 [130363]
    Other proteins in same PDB: d2cf2a1, d2cf2a2, d2cf2c1, d2cf2j1, d2cf2j2, d2cf2l1

Details for d2cf2e1

PDB Entry: 2cf2 (more details), 4.3 Å

PDB Description: architecture of mammalian fatty acid synthase
PDB Compounds: (E:) fatty acid synthase, kr domain

SCOPe Domain Sequences for d2cf2e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cf2e1 i.26.1.1 (E:2-239) mammalian fatty acid synthase {Pig (Sus scrofa) [TaxId: 9823]}
nfegkialvtgasrgigraiaetlaargakvigtatsengaqaisdylgangkglmlnvt
dpasiesvlekiraefgevdilvnnagitrdnllmrmkdeewndiietnlssvfrlskav
mrammkkrhgriitiggqanyaaakagligfskslarevasrgitvnvvapgfietsddq
ragilaqvpagrlggaqeianavaflasdeaayitgetlhvng

SCOPe Domain Coordinates for d2cf2e1:

Click to download the PDB-style file with coordinates for d2cf2e1.
(The format of our PDB-style files is described here.)

Timeline for d2cf2e1: