SCOPe 2.03: Domain d2cf2a2: 2cf2 A:254-406

Lineage for d2cf2a2 (2cf2 A:254-406)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.1: Thiolase-related [53902] (9 proteins)

6. Protein Beta-ketoacyl-ACP synthase I [53907] (1 species)

7. Species Escherichia coli [TaxId:562] [53908] (23 PDB entries)
   Uniprot P14926

8. Domain d2cf2a2: 2cf2 A:254-406 [130361]
   Other proteins in same PDB: d2cf2c1, d2cf2e1, d2cf2l1, d2cf2n1
   automatically matched to d1dd8a2

Details for d2cf2a2

PDB Entry: 2cf2, 4.3 Å

PDB Description: architecture of mammalian fatty acid synthase

PDB Compounds: (A:) fatty acid synthase, ks domain

SCOPe Domain Sequences for d2cf2a2:

Sequence; same for both SEQRES and ATOM records:

>d2cf2a2 c.95.1.1 (A:254-406) Beta-ketoacyl-ACP synthase I {Escherichia coli [TaxId: 562]}
yaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgtstpvgdvkelaai
revfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsinieeldeqaaglni
vtettdrelttvmsnsfgfggtnatlvmrklkd

Timeline for d2cf2a2:

• d2cf2a2 first appeared in SCOP 1.73
  
• d2cf2a2 appears in SCOPe 2.02
  
• d2cf2a2 appears in SCOPe 2.04
  
• d2cf2a2 appears in the current release, SCOPe 2.08