Lineage for d2ceqb1 (2ceq B:1-489)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 682152Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 683071Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (5 proteins)
  6. 683171Protein beta-Glycosidase [51531] (2 species)
  7. 683172Species Archaeon Sulfolobus solfataricus [TaxId:2287] [51532] (9 PDB entries)
  8. 683182Domain d2ceqb1: 2ceq B:1-489 [130353]
    automatically matched to d1uwqa_
    complexed with act, gim

Details for d2ceqb1

PDB Entry: 2ceq (more details), 2.14 Å

PDB Description: beta-glycosidase from sulfolobus solfataricus in complex with glucoimidazole
PDB Compounds: (B:) beta-galactosidase

SCOP Domain Sequences for d2ceqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ceqb1 c.1.8.4 (B:1-489) beta-Glycosidase {Archaeon Sulfolobus solfataricus [TaxId: 2287]}
mysfpnsfrfgwsqagfqsemgtpgsedpntdwykwvhdpenmaaglvsgdlpengpgyw
gnyktfhdnaqkmglkiarlnvewsrifpnplprpqnfdeskqdvteveinenelkrlde
yankdalnhyreifkdlksrglyfilnmyhwplplwlhdpirvrrgdftgpsgwlstrtv
yefarfsayiawkfddlvdeystmnepnvvgglgyvgvksgfppgylsfelsrramynii
qaharaydgiksvskkpvgiiyanssfqpltdkdmeavemaendnrwwffdaiirgeitr
gnekivrddlkgrldwigvnyytrtvvkrtekgyvslggyghgcernsvslaglptsdfg
weffpeglydvltkywnryhlymyvtengiaddadyqrpyylvshvyqvhrainsgadvr
gylhwsladnyewasgfsmrfgllkvdyntkrlywrpsalvyreiatngaitdeiehlns
vppvkplrh

SCOP Domain Coordinates for d2ceqb1:

Click to download the PDB-style file with coordinates for d2ceqb1.
(The format of our PDB-style files is described here.)

Timeline for d2ceqb1: