SCOPe 2.08: Domain d2ceia_: 2cei A:

Lineage for d2ceia_ (2cei A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein automated matches [190041] (34 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187027] (13 PDB entries)

8. Domain d2ceia_: 2cei A: [130344]
   automated match to d1fha__
   complexed with zn; mutant

Details for d2ceia_

PDB Entry: 2cei, 1.8 Å

PDB Description: recombinant human h ferritin, k86q mutant, soaked with zn

PDB Compounds: (A:) ferritin heavy chain

SCOPe Domain Sequences for d2ceia_:

Sequence; same for both SEQRES and ATOM records:

>d2ceia_ a.25.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheere
haeklmklqnqrggriflqdiqkpdcddwesglnamecalhleknvnqsllelhklatdk
ndphlcdfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlg

Timeline for d2ceia_:

• d2ceia_ first appeared in SCOP 1.73, called d2ceia1
  
• d2ceia_ appears in SCOPe 2.07