Lineage for d2ceac1 (2cea C:411-603)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 651959Fold a.269: FtsH protease domain-like [140989] (1 superfamily)
    array of 6 helices and a 2-stranded beta-ribbon
  4. 651960Superfamily a.269.1: FtsH protease domain-like [140990] (1 family) (S)
    contains zincin-like (scop_sf 55486) metal-binding motif HExxH, embedded into a topologically different fold
  5. 651961Family a.269.1.1: FtsH protease domain-like [140991] (1 protein)
    Pfam PF01434; Peptidase family M41
  6. 651962Protein Cell division protein FtsH, C-terminal domain [140992] (2 species)
  7. 651966Species Thermotoga maritima [TaxId:2336] [140994] (2 PDB entries)
  8. 651975Domain d2ceac1: 2cea C:411-603 [130336]
    Other proteins in same PDB: d2ceaa2, d2ceab2, d2ceac2, d2cead2, d2ceae2, d2ceaf2
    automatically matched to 2CE7 A:411-603
    complexed with adp, mg, zn; mutant

Details for d2ceac1

PDB Entry: 2cea (more details), 2.75 Å

PDB Description: cell division protein ftsh
PDB Compounds: (C:) cell division protein ftsh

SCOP Domain Sequences for d2ceac1:

Sequence, based on SEQRES records: (download)

>d2ceac1 a.269.1.1 (C:411-603) Cell division protein FtsH, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
lispaekriiayheaghavvstvvpngepvhrisiiprgykalgytlhlpeedkylvsrn
elldkltallggraaeevvfgdvtsgaandierateiarnmvcqlgmseelgplawgkee
qevflgkeitrlrnyseevaskideevkkivtncyerakeiirkyrkqldniveilleke
tiegdelrrilse

Sequence, based on observed residues (ATOM records): (download)

>d2ceac1 a.269.1.1 (C:411-603) Cell division protein FtsH, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
lispaekriiayheaghavvstvvpngepvhrisiiprgykalgytlhlpeedkylvsrn
elldkltallggraaeevvfgdvtsgaandierateiarnmvcqlgmseelgplawgrny
seevaskideevkkivtncyerakeiirkyrkqldniveilleketiegdelrrilse

SCOP Domain Coordinates for d2ceac1:

Click to download the PDB-style file with coordinates for d2ceac1.
(The format of our PDB-style files is described here.)

Timeline for d2ceac1: