Lineage for d2ce9a_ (2ce9 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2075644Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2075799Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2075800Family b.69.4.1: WD40-repeat [50979] (13 proteins)
    this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain
  6. 2075876Protein Groucho/tle1, C-terminal domain [75009] (1 species)
  7. 2075877Species Human (Homo sapiens) [TaxId:9606] [75010] (4 PDB entries)
  8. 2075884Domain d2ce9a_: 2ce9 A: [130328]
    automated match to d1gxra_

Details for d2ce9a_

PDB Entry: 2ce9 (more details), 2.12 Å

PDB Description: a wrpw peptide bound to the groucho-tle wd40 domain.
PDB Compounds: (A:) transducin-like enhancer protein 1

SCOPe Domain Sequences for d2ce9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ce9a_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
dyfqgamgskpaysfhvtadgqmqpvpfppdaligpgiprharqintlnhgevvcavtis
nptrhvytggkgcvkvwdishpgnkspvsqldclnrdnyirsckllpdgctlivggeast
lsiwdlaaptprikaeltssapacyalaispdskvcfsccsdgniavwdlhnqtlvrqfq
ghtdgascidisndgtklwtggldntvrswdlregrqlqqhdftsqifslgycptgewla
vgmessnvevlhvnkpdkyqlhlhescvlslkfaycgkwfvstgkdnllnawrtpygasi
fqskesssvlscdisvddkyivtgsgdkkatvyeviy

SCOPe Domain Coordinates for d2ce9a_:

Click to download the PDB-style file with coordinates for d2ce9a_.
(The format of our PDB-style files is described here.)

Timeline for d2ce9a_: