Lineage for d2ce8d2 (2ce8 D:443-770)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2399102Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2399257Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2399258Family b.69.4.1: WD40-repeat [50979] (17 protein domains)
  6. 2399334Protein Groucho/tle1, C-terminal domain [75009] (1 species)
  7. 2399335Species Human (Homo sapiens) [TaxId:9606] [75010] (4 PDB entries)
  8. 2399341Domain d2ce8d2: 2ce8 D:443-770 [130327]
    Other proteins in same PDB: d2ce8a3, d2ce8b3, d2ce8c3, d2ce8d3
    automated match to d1gxra_

Details for d2ce8d2

PDB Entry: 2ce8 (more details), 2.03 Å

PDB Description: an eh1 peptide bound to the groucho-tle wd40 domain.
PDB Compounds: (D:) transducin-like enhancer protein 1

SCOPe Domain Sequences for d2ce8d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ce8d2 b.69.4.1 (D:443-770) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
kpaysfhvtadgqmqpvpfppdaligpgiprharqintlnhgevvcavtisnptrhvytg
gkgcvkvwdishpgnkspvsqldclnrdnyirsckllpdgctlivggeastlsiwdlaap
tprikaeltssapacyalaispdskvcfsccsdgniavwdlhnqtlvrqfqghtdgasci
disndgtklwtggldntvrswdlregrqlqqhdftsqifslgycptgewlavgmessnve
vlhvnkpdkyqlhlhescvlslkfaycgkwfvstgkdnllnawrtpygasifqskesssv
lscdisvddkyivtgsgdkkatvyeviy

SCOPe Domain Coordinates for d2ce8d2:

Click to download the PDB-style file with coordinates for d2ce8d2.
(The format of our PDB-style files is described here.)

Timeline for d2ce8d2: