![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.69.4: WD40 repeat-like [50978] (4 families) ![]() also contains 8-bladed propellers |
![]() | Family b.69.4.1: WD40-repeat [50979] (17 proteins) this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain |
![]() | Protein Groucho/tle1, C-terminal domain [75009] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [75010] (4 PDB entries) |
![]() | Domain d2ce8c2: 2ce8 C:443-770 [130326] Other proteins in same PDB: d2ce8a3, d2ce8b3, d2ce8c3, d2ce8d3 automated match to d1gxra_ has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2ce8 (more details), 2.03 Å
SCOPe Domain Sequences for d2ce8c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ce8c2 b.69.4.1 (C:443-770) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} kpaysfhvtadgqmqpvpfppdaligpgiprharqintlnhgevvcavtisnptrhvytg gkgcvkvwdishpgnkspvsqldclnrdnyirsckllpdgctlivggeastlsiwdlaap tprikaeltssapacyalaispdskvcfsccsdgniavwdlhnqtlvrqfqghtdgasci disndgtklwtggldntvrswdlregrqlqqhdftsqifslgycptgewlavgmessnve vlhvnkpdkyqlhlhescvlslkfaycgkwfvstgkdnllnawrtpygasifqskesssv lscdisvddkyivtgsgdkkatvyeviy
Timeline for d2ce8c2: