Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.20: Extended AAA-ATPase domain [81269] (43 proteins) fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain |
Protein AAA domain of cell division protein FtsH [82418] (3 species) ATP-dependent protease |
Species Thermotoga maritima [TaxId:2336] [142325] (3 PDB entries) Uniprot Q9WZ49 150-402 |
Domain d2ce7f2: 2ce7 F:150-402 [130323] Other proteins in same PDB: d2ce7a1, d2ce7b1, d2ce7c1, d2ce7d1, d2ce7e1, d2ce7f1 automated match to d2ce7a2 complexed with adp, mg, zn |
PDB Entry: 2ce7 (more details), 2.44 Å
SCOPe Domain Sequences for d2ce7f2:
Sequence, based on SEQRES records: (download)
>d2ce7f2 c.37.1.20 (F:150-402) AAA domain of cell division protein FtsH {Thermotoga maritima [TaxId: 2336]} ykpsgnkrvtfkdvggaeeaieelkevveflkdpskfnrigarmpkgillvgppgtgktl laravageanvpffhisgsdfvelfvgvgaarvrdlfaqakahapcivfideidavgrhr gaglggghdereqtlnqllvemdgfdskegiivmaatnrpdildpallrpgrfdkkivvd ppdmlgrkkileihtrnkplaedvnleiiakrtpgfvgadlenlvneaallaaregrdki tmkdfeeaidrvi
>d2ce7f2 c.37.1.20 (F:150-402) AAA domain of cell division protein FtsH {Thermotoga maritima [TaxId: 2336]} ykpsgnkrvtfkdvggaeeaieelkevveflkdpskfnrigarmpkgillvgppgtgktl laravageanvpffhisgsdfvelfvgvgaarvrdlfaqakahapcivfideidavgrde reqtlnqllvemdgfdskegiivmaatnrpdildpallrpgrfdkkivvdppdmlgrkki leihtrnkplaedvnleiiakrtpgfvgadlenlvneaallaaregrdkitmkdfeeaid rvi
Timeline for d2ce7f2: