![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.20: Extended AAA-ATPase domain [81269] (42 proteins) fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain |
![]() | Protein AAA domain of cell division protein FtsH [82418] (3 species) ATP-dependent protease |
![]() | Species Thermotoga maritima [TaxId:2336] [142325] (3 PDB entries) Uniprot Q9WZ49 150-402 |
![]() | Domain d2ce7e2: 2ce7 E:152-402 [130321] Other proteins in same PDB: d2ce7a1, d2ce7b1, d2ce7c1, d2ce7d1, d2ce7e1, d2ce7f1 automated match to d2ce7a2 complexed with adp, mg, zn |
PDB Entry: 2ce7 (more details), 2.44 Å
SCOPe Domain Sequences for d2ce7e2:
Sequence, based on SEQRES records: (download)
>d2ce7e2 c.37.1.20 (E:152-402) AAA domain of cell division protein FtsH {Thermotoga maritima [TaxId: 2336]} psgnkrvtfkdvggaeeaieelkevveflkdpskfnrigarmpkgillvgppgtgktlla ravageanvpffhisgsdfvelfvgvgaarvrdlfaqakahapcivfideidavgrhrga glggghdereqtlnqllvemdgfdskegiivmaatnrpdildpallrpgrfdkkivvdpp dmlgrkkileihtrnkplaedvnleiiakrtpgfvgadlenlvneaallaaregrdkitm kdfeeaidrvi
>d2ce7e2 c.37.1.20 (E:152-402) AAA domain of cell division protein FtsH {Thermotoga maritima [TaxId: 2336]} psgnkrvtfkdvggaeeaieelkevveflkdpskfnrigarmpkgillvgppgtgktlla ravageanvpffhisgsdfvelfvgvgaarvrdlfaqakahapcivfideidavgrhere qtlnqllvemdgfdskegiivmaatnrpdildpallrpgrfdkkivvdppdmlgrkkile ihtrnkplaedvnleiiakrtpgfvgadlenlvneaallaaregrdkitmkdfeeaidrv i
Timeline for d2ce7e2: