Lineage for d2ce7c2 (2ce7 C:150-402)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870969Family c.37.1.20: Extended AAA-ATPase domain [81269] (43 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 2870970Protein AAA domain of cell division protein FtsH [82418] (3 species)
    ATP-dependent protease
  7. 2870973Species Thermotoga maritima [TaxId:2336] [142325] (3 PDB entries)
    Uniprot Q9WZ49 150-402
  8. 2870979Domain d2ce7c2: 2ce7 C:150-402 [130317]
    Other proteins in same PDB: d2ce7a1, d2ce7b1, d2ce7c1, d2ce7d1, d2ce7e1, d2ce7f1
    automated match to d2ce7a2
    complexed with adp, mg, zn

Details for d2ce7c2

PDB Entry: 2ce7 (more details), 2.44 Å

PDB Description: edta treated
PDB Compounds: (C:) cell division protein ftsh

SCOPe Domain Sequences for d2ce7c2:

Sequence, based on SEQRES records: (download)

>d2ce7c2 c.37.1.20 (C:150-402) AAA domain of cell division protein FtsH {Thermotoga maritima [TaxId: 2336]}
ykpsgnkrvtfkdvggaeeaieelkevveflkdpskfnrigarmpkgillvgppgtgktl
laravageanvpffhisgsdfvelfvgvgaarvrdlfaqakahapcivfideidavgrhr
gaglggghdereqtlnqllvemdgfdskegiivmaatnrpdildpallrpgrfdkkivvd
ppdmlgrkkileihtrnkplaedvnleiiakrtpgfvgadlenlvneaallaaregrdki
tmkdfeeaidrvi

Sequence, based on observed residues (ATOM records): (download)

>d2ce7c2 c.37.1.20 (C:150-402) AAA domain of cell division protein FtsH {Thermotoga maritima [TaxId: 2336]}
ykpsgnkrvtfkdvggaeeaieelkevveflkdpskfnrigarmpkgillvgppgtgktl
laravageanvpffhisgsdfvelfvgvgaarvrdlfaqakahapcivfideidavgreq
tlnqllvemdgfdskegiivmaatnrpdildpallrpgrfdkkivvdppdmlgrkkilei
htrnkplaedvnleiiakrtpgfvgadlenlvneaallaaregrdkitmkdfeeaidrvi

SCOPe Domain Coordinates for d2ce7c2:

Click to download the PDB-style file with coordinates for d2ce7c2.
(The format of our PDB-style files is described here.)

Timeline for d2ce7c2: