SCOPe 2.08: Domain d2ce7c1: 2ce7 C:411-606

Lineage for d2ce7c1 (2ce7 C:411-606)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.269: FtsH protease domain-like [140989] (1 superfamily)
   array of 6 helices and a 2-stranded beta-ribbon

4. Superfamily a.269.1: FtsH protease domain-like [140990] (1 family)
   contains zincin-like (55486) metal-binding motif HExxH, embedded into a topologically different fold
   automatically mapped to Pfam PF01434

5. Family a.269.1.1: FtsH protease domain-like [140991] (2 proteins)
   Pfam PF01434; Peptidase family M41

6. Protein Cell division protein FtsH, C-terminal domain [140992] (2 species)

7. Species Thermotoga maritima [TaxId:2336] [140994] (2 PDB entries)
   Uniprot Q9WZ49 411-603

8. Domain d2ce7c1: 2ce7 C:411-606 [130316]
   Other proteins in same PDB: d2ce7a2, d2ce7b2, d2ce7c2, d2ce7d2, d2ce7e2, d2ce7f2
   automated match to d2ce7a1
   complexed with adp, mg, zn

Details for d2ce7c1

PDB Entry: 2ce7, 2.44 Å

PDB Description: edta treated

PDB Compounds: (C:) cell division protein ftsh

SCOPe Domain Sequences for d2ce7c1:

Sequence, based on SEQRES records:

>d2ce7c1 a.269.1.1 (C:411-606) Cell division protein FtsH, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
lispaekriiayheaghavvstvvpngepvhrisiiprgykalgytlhlpeedkylvsrn
elldkltallggraaeevvfgdvtsgaandierateiarnmvcqlgmseelgplawgkee
qevflgkeitrlrnyseevaskideevkkivtncyerakeiirkyrkqldniveilleke
tiegdelrrilseefe

Sequence, based on observed residues (ATOM records):

>d2ce7c1 a.269.1.1 (C:411-606) Cell division protein FtsH, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
lispaekriiayheaghavvstvvpngepvhrisiiprgykalgytlhlpeedkylvsrn
elldkltallggraaeevvfgdvtsgaandierateiarnmvcqlgmseelgplawgrny
seevaskideevkkivtncyerakeiirkyrkqldniveilleketiegdelrrilseef
e

Timeline for d2ce7c1:

• d2ce7c1 first appeared in SCOP 1.73
  
• d2ce7c1 appears in SCOPe 2.07