Lineage for d2ce7a1 (2ce7 A:411-603)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2020716Fold a.269: FtsH protease domain-like [140989] (1 superfamily)
    array of 6 helices and a 2-stranded beta-ribbon
  4. 2020717Superfamily a.269.1: FtsH protease domain-like [140990] (1 family) (S)
    contains zincin-like (55486) metal-binding motif HExxH, embedded into a topologically different fold
    automatically mapped to Pfam PF01434
  5. 2020718Family a.269.1.1: FtsH protease domain-like [140991] (2 proteins)
    Pfam PF01434; Peptidase family M41
  6. 2020719Protein Cell division protein FtsH, C-terminal domain [140992] (2 species)
  7. 2020723Species Thermotoga maritima [TaxId:2336] [140994] (2 PDB entries)
    Uniprot Q9WZ49 411-603
  8. 2020724Domain d2ce7a1: 2ce7 A:411-603 [130312]
    Other proteins in same PDB: d2ce7a2, d2ce7b2, d2ce7c2, d2ce7d2, d2ce7e2, d2ce7f2
    complexed with adp, mg, zn

Details for d2ce7a1

PDB Entry: 2ce7 (more details), 2.44 Å

PDB Description: edta treated
PDB Compounds: (A:) cell division protein ftsh

SCOPe Domain Sequences for d2ce7a1:

Sequence, based on SEQRES records: (download)

>d2ce7a1 a.269.1.1 (A:411-603) Cell division protein FtsH, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
lispaekriiayheaghavvstvvpngepvhrisiiprgykalgytlhlpeedkylvsrn
elldkltallggraaeevvfgdvtsgaandierateiarnmvcqlgmseelgplawgkee
qevflgkeitrlrnyseevaskideevkkivtncyerakeiirkyrkqldniveilleke
tiegdelrrilse

Sequence, based on observed residues (ATOM records): (download)

>d2ce7a1 a.269.1.1 (A:411-603) Cell division protein FtsH, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
lispaekriiayheaghavvstvvpngepvhrisiikylvsrnelldkltallggraaee
vvfgdvtsgaandierateiarnmvcqlgmseelgplawgklrnyseevaskideevkki
vtncyerakeiirkyrkqldniveilleketiegdelrrilse

SCOPe Domain Coordinates for d2ce7a1:

Click to download the PDB-style file with coordinates for d2ce7a1.
(The format of our PDB-style files is described here.)

Timeline for d2ce7a1: