![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.154: HPA-like [141085] (1 superfamily) sandwich, 6 strands in 2 sheets; jelly-roll (truncated); also includes the pending PCSK9 V domain-like superfamily (the C-terminal domains of 2p4e and 2pmw) |
![]() | Superfamily b.154.1: Agglutinin HPA-like [141086] (1 family) ![]() forms similar trimers to the PCSK9 V domain; strand directions of the subunit beta-sheets are parallel to the three-fold symmetry axis; |
![]() | Family b.154.1.1: Agglutinin HPA-like [141087] (2 proteins) |
![]() | Protein Agglutinin HPA [141088] (1 species) |
![]() | Species Roman snail (Helix pomatia) [TaxId:6536] [141089] (2 PDB entries) Uniprot Q2F1K8 21-119! Uniprot Q2F1K8 21-120 |
![]() | Domain d2ce6a1: 2ce6 A:1-100 [130311] |
PDB Entry: 2ce6 (more details), 2.4 Å
SCOPe Domain Sequences for d2ce6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ce6a1 b.154.1.1 (A:1-100) Agglutinin HPA {Roman snail (Helix pomatia) [TaxId: 6536]} rvqsgkincgddagwakvpsndpgrdntrelaknitfaspycrppvvllsitqldveqsq nlrviarlysvsptgfkascytwhntkvysmsiswisien
Timeline for d2ce6a1: