![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
![]() | Superfamily c.14.1: ClpP/crotonase [52096] (5 families) ![]() |
![]() | Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
![]() | Protein automated matches [190246] (71 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:83332] [187022] (13 PDB entries) |
![]() | Domain d2ce3k_: 2ce3 K: [130307] automated match to d1tyfa_ |
PDB Entry: 2ce3 (more details), 2.6 Å
SCOPe Domain Sequences for d2ce3k_:
Sequence, based on SEQRES records: (download)
>d2ce3k_ c.14.1.0 (K:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} sltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdislyinspggsisag maiydtmvlapcdiatyamgmaasmgefllaagtkgkryalpharilmhqplggvtgsaa diaiqaeqfavikkemfrlnaeftgqpierieadsdrdrwftaaealeygfvdhiit
>d2ce3k_ c.14.1.0 (K:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} sltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdislyinspggsisag maiydtmvlapcdiatyamgmaasmgefllaagtkgkryalpharilmhqpiaiqaeqfa vikkemfrlnaeftgqpierieadsdrdrwftaaealeygfvdhiit
Timeline for d2ce3k_: