Lineage for d2ce3b1 (2ce3 B:15-191)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 690605Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 690606Superfamily c.14.1: ClpP/crotonase [52096] (4 families) (S)
  5. 690607Family c.14.1.1: Clp protease, ClpP subunit [52097] (1 protein)
  6. 690608Protein Clp protease, ClpP subunit [52098] (5 species)
  7. 690686Species Mycobacterium tuberculosis [TaxId:1773] [141997] (2 PDB entries)
  8. 690695Domain d2ce3b1: 2ce3 B:15-191 [130298]
    automatically matched to 2CBY A:15-193

Details for d2ce3b1

PDB Entry: 2ce3 (more details), 2.6 Å

PDB Description: crystal structure of the atp-dependent clp protease proteolytic subunit 1 (clpp1) from mycobacterium tuberculosis
PDB Compounds: (B:) ATP-dependent clp protease proteolytic subunit 1

SCOP Domain Sequences for d2ce3b1:

Sequence, based on SEQRES records: (download)

>d2ce3b1 c.14.1.1 (B:15-191) Clp protease, ClpP subunit {Mycobacterium tuberculosis [TaxId: 1773]}
sltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdislyinspggsisag
maiydtmvlapcdiatyamgmaasmgefllaagtkgkryalpharilmhqplggvtgsaa
diaiqaeqfavikkemfrlnaeftgqpierieadsdrdrwftaaealeygfvdhiit

Sequence, based on observed residues (ATOM records): (download)

>d2ce3b1 c.14.1.1 (B:15-191) Clp protease, ClpP subunit {Mycobacterium tuberculosis [TaxId: 1773]}
sltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdislyinspggsisag
maiydtmvlapcdiatyamgmaasmgefllaagtkgkryalpharilmhqpiaiqaeqfa
vikkemfrlnaeftgqpierieadsdrdrwftaaealeygfvdhiit

SCOP Domain Coordinates for d2ce3b1:

Click to download the PDB-style file with coordinates for d2ce3b1.
(The format of our PDB-style files is described here.)

Timeline for d2ce3b1: