Lineage for d2ce3b_ (2ce3 B:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. Protein automated matches [190246] (70 species)
    not a true protein
  7. Species Mycobacterium tuberculosis [TaxId:83332] [187022] (13 PDB entries)
  8. Domain d2ce3b_: 2ce3 B: [130298]
    automated match to d1tyfa_

Details for d2ce3b_

PDB Entry: 2ce3 (more details), 2.6 Å

PDB Description: crystal structure of the atp-dependent clp protease proteolytic subunit 1 (clpp1) from mycobacterium tuberculosis
PDB Compounds: (B:) ATP-dependent clp protease proteolytic subunit 1

SCOPe Domain Sequences for d2ce3b_:

Sequence, based on SEQRES records: (download)

>d2ce3b_ c.14.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
sltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdislyinspggsisag
maiydtmvlapcdiatyamgmaasmgefllaagtkgkryalpharilmhqplggvtgsaa
diaiqaeqfavikkemfrlnaeftgqpierieadsdrdrwftaaealeygfvdhiit

Sequence, based on observed residues (ATOM records): (download)

>d2ce3b_ c.14.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
sltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdislyinspggsisag
maiydtmvlapcdiatyamgmaasmgefllaagtkgkryalpharilmhqpiaiqaeqfa
vikkemfrlnaeftgqpierieadsdrdrwftaaealeygfvdhiit

SCOPe Domain Coordinates for d2ce3b_ are not available.

Timeline for d2ce3b_:

Domains from other chains:
(mouse over for more information)
d2ce3a_, d2ce3c_, d2ce3d_, d2ce3e_, d2ce3f_, d2ce3g_, d2ce3h_, d2ce3i_, d2ce3j_, d2ce3k_, d2ce3l_, d2ce3m_, d2ce3n_