SCOP 1.75: Domain d2cdta1: 2cdt A:6-62

Lineage for d2cdta1 (2cdt A:6-62)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (1 family)

5. Family b.34.2.1: SH3-domain [50045] (39 proteins)

6. Protein alpha-Spectrin, SH3 domain [50058] (1 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [50059] (21 PDB entries)

8. Domain d2cdta1: 2cdt A:6-62 [130296]
   automatically matched to d1pwt__
   mutant

Details for d2cdta1

PDB Entry: 2cdt, 2.54 Å

PDB Description: alpha-spectrin sh3 domain a56s mutant

PDB Compounds: (A:) spectrin alpha chain

SCOP Domain Sequences for d2cdta1:

Sequence; same for both SEQRES and ATOM records:

>d2cdta1 b.34.2.1 (A:6-62) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]}
kelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevndrqgfvpasyvkkld

Timeline for d2cdta1:

• d2cdta1 first appeared in SCOP 1.73
  
• d2cdta1 is called d2cdta_ in SCOPe 2.01
  
• d2cdta1 appears in the current release, SCOPe 2.08, called d2cdta_