Lineage for d2cdta1 (2cdt A:6-62)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 665027Fold b.34: SH3-like barrel [50036] (18 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 665103Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 665104Family b.34.2.1: SH3-domain [50045] (38 proteins)
  6. 665127Protein alpha-Spectrin, SH3 domain [50058] (1 species)
  7. 665128Species Chicken (Gallus gallus) [TaxId:9031] [50059] (21 PDB entries)
  8. 665142Domain d2cdta1: 2cdt A:6-62 [130296]
    automatically matched to d1pwt__
    mutant

Details for d2cdta1

PDB Entry: 2cdt (more details), 2.54 Å

PDB Description: alpha-spectrin sh3 domain a56s mutant
PDB Compounds: (A:) spectrin alpha chain

SCOP Domain Sequences for d2cdta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cdta1 b.34.2.1 (A:6-62) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]}
kelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevndrqgfvpasyvkkld

SCOP Domain Coordinates for d2cdta1:

Click to download the PDB-style file with coordinates for d2cdta1.
(The format of our PDB-style files is described here.)

Timeline for d2cdta1: