Lineage for d2cdta_ (2cdt A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2783254Protein automated matches [190043] (8 species)
    not a true protein
  7. 2783262Species Chicken (Gallus gallus) [TaxId:9031] [187080] (10 PDB entries)
  8. 2783274Domain d2cdta_: 2cdt A: [130296]
    automated match to d1pwt__
    mutant

Details for d2cdta_

PDB Entry: 2cdt (more details), 2.54 Å

PDB Description: alpha-spectrin sh3 domain a56s mutant
PDB Compounds: (A:) spectrin alpha chain

SCOPe Domain Sequences for d2cdta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cdta_ b.34.2.1 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
kelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevndrqgfvpasyvkkld

SCOPe Domain Coordinates for d2cdta_:

Click to download the PDB-style file with coordinates for d2cdta_.
(The format of our PDB-style files is described here.)

Timeline for d2cdta_: