![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.18: ACT-like [55021] (15 families) ![]() regulatory domain linked to a wide range of metabolic enzymes |
![]() | Family d.58.18.10: Aspartokinase allosteric domain-like [143390] (1 protein) duplication: tandem repeat of two ACT-like domains; similar subunit and oligomeric structures to the VC0802-like family |
![]() | Protein Aspartokinase [143391] (3 species) |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [143394] (1 PDB entry) Uniprot Q9LYU8 388-478! Uniprot Q9LYU8 479-553 |
![]() | Domain d2cdqb3: 2cdq B:420-494 [130295] Other proteins in same PDB: d2cdqa1, d2cdqb1 automated match to d2cdqa3 complexed with lys, sam, tar |
PDB Entry: 2cdq (more details), 2.85 Å
SCOPe Domain Sequences for d2cdqb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cdqb3 d.58.18.10 (B:420-494) Aspartokinase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} raiislignvqhsslilerafhvlytkgvnvqmisqgaskvnisfivneaeaegcvqalh ksffesgdlselliq
Timeline for d2cdqb3: