Lineage for d2cdqb3 (2cdq B:420-494)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2954059Superfamily d.58.18: ACT-like [55021] (15 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 2954208Family d.58.18.10: Aspartokinase allosteric domain-like [143390] (1 protein)
    duplication: tandem repeat of two ACT-like domains; similar subunit and oligomeric structures to the VC0802-like family
  6. 2954209Protein Aspartokinase [143391] (3 species)
  7. 2954226Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [143394] (1 PDB entry)
    Uniprot Q9LYU8 388-478! Uniprot Q9LYU8 479-553
  8. 2954230Domain d2cdqb3: 2cdq B:420-494 [130295]
    Other proteins in same PDB: d2cdqa1, d2cdqb1
    automated match to d2cdqa3
    complexed with lys, sam, tar

Details for d2cdqb3

PDB Entry: 2cdq (more details), 2.85 Å

PDB Description: crystal structure of arabidopsis thaliana aspartate kinase complexed with lysine and s-adenosylmethionine
PDB Compounds: (B:) aspartokinase

SCOPe Domain Sequences for d2cdqb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cdqb3 d.58.18.10 (B:420-494) Aspartokinase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
raiislignvqhsslilerafhvlytkgvnvqmisqgaskvnisfivneaeaegcvqalh
ksffesgdlselliq

SCOPe Domain Coordinates for d2cdqb3:

Click to download the PDB-style file with coordinates for d2cdqb3.
(The format of our PDB-style files is described here.)

Timeline for d2cdqb3: