Lineage for d2cdqb1 (2cdq B:25-328)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 708177Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest
  4. 708178Superfamily c.73.1: Carbamate kinase-like [53633] (3 families) (S)
    the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase
  5. 708221Family c.73.1.3: PyrH-like [142721] (3 proteins)
    part of Pfam PF00696
  6. 708222Protein Aspartokinase [142724] (3 species)
  7. 708232Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [142725] (1 PDB entry)
  8. 708234Domain d2cdqb1: 2cdq B:25-328 [130293]
    Other proteins in same PDB: d2cdqa2, d2cdqa3, d2cdqb2, d2cdqb3
    automatically matched to 2CDQ A:25-328
    complexed with lys, sam, tar

Details for d2cdqb1

PDB Entry: 2cdq (more details), 2.85 Å

PDB Description: crystal structure of arabidopsis thaliana aspartate kinase complexed with lysine and s-adenosylmethionine
PDB Compounds: (B:) aspartokinase

SCOP Domain Sequences for d2cdqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cdqb1 c.73.1.3 (B:25-328) Aspartokinase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
kgitcvmkfggssvasaermkevadliltfpeespvivlsamgkttnnlllagekavscg
vsnaseieelsiikelhirtvkelnidpsviltyleeleqllkgiammkeltlrtrdylv
sfgeclstrifaaylntigvkarqydafeigfittddftngdileatypavakrlyddwm
hdpavpivtgflgkgwktgavttlgrggsdltattigkalglkeiqvwkdvdgvltcdpt
iykratpvpyltfdeaaelayfgaqvlhpqsmrparegeipvrvknsynpkapgtiitkt
rdmt

SCOP Domain Coordinates for d2cdqb1:

Click to download the PDB-style file with coordinates for d2cdqb1.
(The format of our PDB-style files is described here.)

Timeline for d2cdqb1: