![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.73: Carbamate kinase-like [53632] (1 superfamily) 3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest |
![]() | Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) ![]() the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase |
![]() | Family c.73.1.3: PyrH-like [142721] (4 proteins) part of Pfam PF00696 |
![]() | Protein Aspartokinase [142724] (3 species) |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [142725] (1 PDB entry) Uniprot Q9LYU8 84-387 |
![]() | Domain d2cdqb1: 2cdq B:25-328 [130293] Other proteins in same PDB: d2cdqa2, d2cdqa3, d2cdqb2, d2cdqb3 automated match to d2cdqa1 complexed with lys, sam, tar |
PDB Entry: 2cdq (more details), 2.85 Å
SCOPe Domain Sequences for d2cdqb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cdqb1 c.73.1.3 (B:25-328) Aspartokinase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} kgitcvmkfggssvasaermkevadliltfpeespvivlsamgkttnnlllagekavscg vsnaseieelsiikelhirtvkelnidpsviltyleeleqllkgiammkeltlrtrdylv sfgeclstrifaaylntigvkarqydafeigfittddftngdileatypavakrlyddwm hdpavpivtgflgkgwktgavttlgrggsdltattigkalglkeiqvwkdvdgvltcdpt iykratpvpyltfdeaaelayfgaqvlhpqsmrparegeipvrvknsynpkapgtiitkt rdmt
Timeline for d2cdqb1: