Lineage for d2cdna1 (2cdn A:1-181)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 695087Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (20 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 695092Protein Adenylate kinase [52554] (14 species)
  7. 695146Species Mycobacterium tuberculosis [TaxId:1773] [102343] (2 PDB entries)
    contains no zinc finger-like insertion
  8. 695147Domain d2cdna1: 2cdn A:1-181 [130289]
    automatically matched to d1p4sa_
    complexed with adp, mg

Details for d2cdna1

PDB Entry: 2cdn (more details), 1.9 Å

PDB Description: crystal structure of mycobacterium tuberculosis adenylate kinase complexed with two molecules of adp and mg
PDB Compounds: (A:) adenylate kinase

SCOP Domain Sequences for d2cdna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}
mrvlllgppgagkgtqavklaeklgipqistgelfrrnieegtklgveakryldagdlvp
sdltnelvddrlnnpdaangfildgyprsveqakalhemlerrgtdidavlefrvseevl
lerlkgrgraddtddvilnrmkvyrdetaplleyyrdqlktvdavgtmdevfaralralg
k

SCOP Domain Coordinates for d2cdna1:

Click to download the PDB-style file with coordinates for d2cdna1.
(The format of our PDB-style files is described here.)

Timeline for d2cdna1: