Lineage for d2cdna2 (2cdn A:1-181)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2865685Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2865690Protein Adenylate kinase [52554] (16 species)
  7. 2865748Species Mycobacterium tuberculosis [TaxId:1773] [102343] (2 PDB entries)
    contains no zinc finger-like insertion
  8. 2865749Domain d2cdna2: 2cdn A:1-181 [130289]
    Other proteins in same PDB: d2cdna3
    complexed with adp, mg

Details for d2cdna2

PDB Entry: 2cdn (more details), 1.9 Å

PDB Description: crystal structure of mycobacterium tuberculosis adenylate kinase complexed with two molecules of adp and mg
PDB Compounds: (A:) adenylate kinase

SCOPe Domain Sequences for d2cdna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cdna2 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}
mrvlllgppgagkgtqavklaeklgipqistgelfrrnieegtklgveakryldagdlvp
sdltnelvddrlnnpdaangfildgyprsveqakalhemlerrgtdidavlefrvseevl
lerlkgrgraddtddvilnrmkvyrdetaplleyyrdqlktvdavgtmdevfaralralg
k

SCOPe Domain Coordinates for d2cdna2:

Click to download the PDB-style file with coordinates for d2cdna2.
(The format of our PDB-style files is described here.)

Timeline for d2cdna2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2cdna3