![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins) parallel beta-sheet of 5 strands, order 23145 |
![]() | Protein Adenylate kinase [52554] (16 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [102343] (2 PDB entries) contains no zinc finger-like insertion |
![]() | Domain d2cdna2: 2cdn A:1-181 [130289] Other proteins in same PDB: d2cdna3 complexed with adp, mg |
PDB Entry: 2cdn (more details), 1.9 Å
SCOPe Domain Sequences for d2cdna2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cdna2 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} mrvlllgppgagkgtqavklaeklgipqistgelfrrnieegtklgveakryldagdlvp sdltnelvddrlnnpdaangfildgyprsveqakalhemlerrgtdidavlefrvseevl lerlkgrgraddtddvilnrmkvyrdetaplleyyrdqlktvdavgtmdevfaralralg k
Timeline for d2cdna2: