Lineage for d2cdhs1 (2cdh S:10-289)

  1. Root: SCOP 1.73
  2. 753709Class i: Low resolution protein structures [58117] (26 folds)
  3. 756015Fold i.26: Fatty acid synthase [144301] (1 superfamily)
  4. 756016Superfamily i.26.1: Fatty acid synthase [144302] (1 family) (S)
  5. 756017Family i.26.1.1: Fatty acid syntase [144303] (2 proteins)
  6. 756018Protein Fungal fatty acid syntase [144306] (1 species)
  7. 756019Species Thermomyces lanuginosus [TaxId:5541] [144307] (1 PDB entry)
  8. 756020Domain d2cdhs1: 2cdh S:10-289 [130288]
    Other proteins in same PDB: d2cdha1, d2cdha2, d2cdhb1, d2cdhb2, d2cdhc1, d2cdhc2, d2cdhd1, d2cdhd2, d2cdhe1, d2cdhe2, d2cdhf1, d2cdhf2, d2cdhg1, d2cdhh1, d2cdhi1, d2cdhj1, d2cdhk1, d2cdhl1

Details for d2cdhs1

PDB Entry: 2cdh (more details), 5 Å

PDB Description: architecture of the thermomyces lanuginosus fungal fatty acid synthase at 5 angstrom resolution.
PDB Compounds: (S:) dehydratase

SCOP Domain Sequences for d2cdhs1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cdhs1 i.26.1.1 (S:10-289) Fungal fatty acid syntase {Thermomyces lanuginosus [TaxId: 5541]}
aigqklppfsyayteleaimyalgvgasikdpkdlkfiyegssdfsclptfgviigqksm
mvlhgeqylelykplpragklkceavvadvlvviimdvysysekelichnqfslflsdkv
kvavaipnrppdavltdttslnqaalyrlsgdwnplhidpnfaslagfdkpilhglctfg
fsarrvlqqfadndvsrfkavkarfakpvypgqtlqtemwkegnrihfqtkvqetgdivi
snayvdla

SCOP Domain Coordinates for d2cdhs1:

Click to download the PDB-style file with coordinates for d2cdhs1.
(The format of our PDB-style files is described here.)

Timeline for d2cdhs1: