Lineage for d2cdhf2 (2cdh F:254-406)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 846958Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 846959Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 846960Family c.95.1.1: Thiolase-related [53902] (8 proteins)
  6. 846981Protein Beta-ketoacyl-ACP synthase I [53907] (1 species)
  7. 846982Species Escherichia coli [TaxId:562] [53908] (23 PDB entries)
    Uniprot P14926
  8. 847166Domain d2cdhf2: 2cdh F:254-406 [130281]
    Other proteins in same PDB: d2cdhg1, d2cdhh1, d2cdhi1, d2cdhj1, d2cdhk1, d2cdhl1, d2cdhs1
    automatically matched to d1dd8a2

Details for d2cdhf2

PDB Entry: 2cdh (more details), 4.2 Å

PDB Description: architecture of the thermomyces lanuginosus fungal fatty acid synthase at 5 angstrom resolution.
PDB Compounds: (F:) ketoacyl synthase

SCOP Domain Sequences for d2cdhf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cdhf2 c.95.1.1 (F:254-406) Beta-ketoacyl-ACP synthase I {Escherichia coli [TaxId: 562]}
yaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgtstpvgdvkelaai
revfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsinieeldeqaaglni
vtettdrelttvmsnsfgfggtnatlvmrklkd

SCOP Domain Coordinates for d2cdhf2:

Click to download the PDB-style file with coordinates for d2cdhf2.
(The format of our PDB-style files is described here.)

Timeline for d2cdhf2: