Lineage for d2cdef2 (2cde F:117-245)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 protein domains)
  6. 656668Protein T-cell antigen receptor [49125] (6 species)
  7. 656679Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (16 PDB entries)
  8. 656698Domain d2cdef2: 2cde F:117-245 [130269]
    Other proteins in same PDB: d2cdeb1, d2cded1, d2cdef1
    automatically matched to d1bd2e2

Details for d2cdef2

PDB Entry: 2cde (more details), 3.5 Å

PDB Description: structure and binding kinetics of three different human cd1d-alpha-galactosylceramide specific t cell receptors -inkt-tcr
PDB Compounds: (F:) inkt-tcr

SCOP Domain Sequences for d2cdef2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cdef2 b.1.1.2 (F:117-245) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpq
plkeqpalndsryalssrlrvsatfwqdprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

SCOP Domain Coordinates for d2cdef2:

Click to download the PDB-style file with coordinates for d2cdef2.
(The format of our PDB-style files is described here.)

Timeline for d2cdef2: