SCOPe 2.08: Domain d2cded2: 2cde D:117-245

Lineage for d2cded2 (2cde D:117-245)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein T-cell antigen receptor [49125] (7 species)
Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (46 PDB entries)
Domain d2cded2: 2cde D:117-245 [130267]
Other proteins in same PDB: d2cdea1, d2cdeb1, d2cded1, d2cdef1
automatically matched to d1bd2e2

Details for d2cded2

PDB Entry: 2cde (more details), 3.5 Å

PDB Description: structure and binding kinetics of three different human cd1d-alpha-galactosylceramide specific t cell receptors -inkt-tcr

PDB Compounds: (D:) inkt-tcr

SCOPe Domain Sequences for d2cded2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cded2 b.1.1.2 (D:117-245) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpq
plkeqpalndsryalssrlrvsatfwqdprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

SCOPe Domain Coordinates for d2cded2:

Click to download the PDB-style file with coordinates for d2cded2.
(The format of our PDB-style files is described here.)

Timeline for d2cded2: