SCOPe 2.05: Domain d2cdeb2: 2cde B:117-245

Lineage for d2cdeb2 (2cde B:117-245)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein T-cell antigen receptor [49125] (7 species)

7. Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (29 PDB entries)

8. Domain d2cdeb2: 2cde B:117-245 [130265]
   Other proteins in same PDB: d2cdea1, d2cdeb1, d2cded1, d2cdef1
   automatically matched to d1bd2e2

Details for d2cdeb2

PDB Entry: 2cde, 3.5 Å

PDB Description: structure and binding kinetics of three different human cd1d-alpha-galactosylceramide specific t cell receptors -inkt-tcr

PDB Compounds: (B:) inkt-tcr

SCOPe Domain Sequences for d2cdeb2:

Sequence; same for both SEQRES and ATOM records:

>d2cdeb2 b.1.1.2 (B:117-245) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpq
plkeqpalndsryalssrlrvsatfwqdprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

Timeline for d2cdeb2:

• d2cdeb2 first appeared in SCOP 1.73
  
• d2cdeb2 appears in SCOPe 2.04
  
• d2cdeb2 appears in SCOPe 2.06
  
• d2cdeb2 appears in the current release, SCOPe 2.08