SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2cdeb2 (2cde B:117-245)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2024239Protein T-cell antigen receptor [49125] (7 species)
  7. 2024270Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (29 PDB entries)
  8. 2024306Domain d2cdeb2: 2cde B:117-245 [130265]
    Other proteins in same PDB: d2cdea1, d2cdeb1, d2cded1, d2cdef1
    automatically matched to d1bd2e2

Details for d2cdeb2

PDB Entry: 2cde (more details), 3.5 Å

PDB Description: structure and binding kinetics of three different human cd1d-alpha-galactosylceramide specific t cell receptors -inkt-tcr
PDB Compounds: (B:) inkt-tcr

SCOPe Domain Sequences for d2cdeb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cdeb2 b.1.1.2 (B:117-245) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpq
plkeqpalndsryalssrlrvsatfwqdprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

SCOPe Domain Coordinates for d2cdeb2:

Click to download the PDB-style file with coordinates for d2cdeb2.
(The format of our PDB-style files is described here.)

Timeline for d2cdeb2: