Lineage for d2cdeb2 (2cde B:117-245)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749668Protein T-cell antigen receptor [49125] (7 species)
  7. 2749711Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (46 PDB entries)
  8. 2749768Domain d2cdeb2: 2cde B:117-245 [130265]
    Other proteins in same PDB: d2cdea1, d2cdeb1, d2cded1, d2cdef1
    automatically matched to d1bd2e2

Details for d2cdeb2

PDB Entry: 2cde (more details), 3.5 Å

PDB Description: structure and binding kinetics of three different human cd1d-alpha-galactosylceramide specific t cell receptors -inkt-tcr
PDB Compounds: (B:) inkt-tcr

SCOPe Domain Sequences for d2cdeb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cdeb2 b.1.1.2 (B:117-245) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpq
plkeqpalndsryalssrlrvsatfwqdprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

SCOPe Domain Coordinates for d2cdeb2:

Click to download the PDB-style file with coordinates for d2cdeb2.
(The format of our PDB-style files is described here.)

Timeline for d2cdeb2: