SCOPe 2.08: Domain d2ccza2: 2ccz A:-6-104

Lineage for d2ccza2 (2ccz A:-6-104)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (14 proteins)
   barrel, closed; n=5, S=10

6. Protein automated matches [190206] (10 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [187026] (3 PDB entries)

8. Domain d2ccza2: 2ccz A:-6-104 [130260]
   Other proteins in same PDB: d2ccza3, d2cczb3
   automated match to d1v1qa_
   protein/DNA complex

Details for d2ccza2

PDB Entry: 2ccz, 2.7 Å

PDB Description: crystal structure of e. coli primosomol protein prib bound to ssdna

PDB Compounds: (A:) primosomal replication protein n

SCOPe Domain Sequences for d2ccza2:

Sequence; same for both SEQRES and ATOM records:

>d2ccza2 b.40.4.3 (A:-6-104) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mdpnslmtnrlvlsgtvcraplrkvspsgiphcqfvlehrsvqeeagfhrqawcqmpviv
sghenqaithsitvgsritvqgfischkaknglskmvlhaeqielidsvd

Timeline for d2ccza2:

• d2ccza2 first appeared in SCOP 1.73, called d2ccza1
  
• d2ccza2 appears in SCOPe 2.07