Lineage for d2ccwa_ (2ccw A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2366402Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2366403Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2366404Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 2366482Protein Azurin [49530] (6 species)
  7. 2366502Species Alcaligenes xylosoxidans, NCIMB (11015), different isoforms [TaxId:85698] [49532] (4 PDB entries)
  8. 2366503Domain d2ccwa_: 2ccw A: [130259]
    automated match to d1dyza_
    complexed with cu1

Details for d2ccwa_

PDB Entry: 2ccw (more details), 1.13 Å

PDB Description: crystal structure of azurin ii at atomic resolution (1.13 angstrom)
PDB Compounds: (A:) azurin II

SCOPe Domain Sequences for d2ccwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ccwa_ b.6.1.1 (A:) Azurin {Alcaligenes xylosoxidans, NCIMB (11015), different isoforms [TaxId: 85698]}
aqceatvesndamqynvkeivvdksckqftmhlkhvgkmakvamghnlvltkdadkqava
tdgmgaglaqdyvkagdtrviahtkvigggesdsvtfdvskiaagenyayfcsfpghwam
mkgtlklgs

SCOPe Domain Coordinates for d2ccwa_:

Click to download the PDB-style file with coordinates for d2ccwa_.
(The format of our PDB-style files is described here.)

Timeline for d2ccwa_: