SCOPe 2.08: Domain d2ccwa_: 2ccw A:

Lineage for d2ccwa_ (2ccw A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein Azurin [49530] (6 species)

7. Species Alcaligenes xylosoxidans, NCIMB (11015), different isoforms [TaxId:85698] [49532] (4 PDB entries)

8. Domain d2ccwa_: 2ccw A: [130259]
   automated match to d1dyza_
   complexed with cu1

Details for d2ccwa_

PDB Entry: 2ccw, 1.13 Å

PDB Description: crystal structure of azurin ii at atomic resolution (1.13 angstrom)

PDB Compounds: (A:) azurin II

SCOPe Domain Sequences for d2ccwa_:

Sequence; same for both SEQRES and ATOM records:

>d2ccwa_ b.6.1.1 (A:) Azurin {Alcaligenes xylosoxidans, NCIMB (11015), different isoforms [TaxId: 85698]}
aqceatvesndamqynvkeivvdksckqftmhlkhvgkmakvamghnlvltkdadkqava
tdgmgaglaqdyvkagdtrviahtkvigggesdsvtfdvskiaagenyayfcsfpghwam
mkgtlklgs

Timeline for d2ccwa_:

• d2ccwa_ first appeared in SCOP 1.73, called d2ccwa1
  
• d2ccwa_ appears in SCOPe 2.07