Lineage for d2ccva1 (2ccv A:1-99)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 680947Fold b.154: HPA-like [141085] (1 superfamily)
    sandwich, 6 strands in 2 sheets; jelly-roll (truncated); also includes the pending PCSK9 V domain-like superfamily (the C-terminal domains of 2p4e and 2pmw)
  4. 680948Superfamily b.154.1: Agglutinin HPA-like [141086] (1 family) (S)
    forms similar trimers to the PCSK9 V domain; strand directions of the subunit beta-sheets are parallel to the three-fold symmetry axis;
  5. 680949Family b.154.1.1: Agglutinin HPA-like [141087] (1 protein)
  6. 680950Protein Agglutinin HPA [141088] (1 species)
  7. 680951Species Roman snail (Helix pomatia) [TaxId:6536] [141089] (2 PDB entries)
  8. 680952Domain d2ccva1: 2ccv A:1-99 [130258]
    complexed with a2g, act, gol, nag, zn

Details for d2ccva1

PDB Entry: 2ccv (more details), 1.3 Å

PDB Description: structure of helix pomatia agglutinin with zinc and n-acetyl-alpha-d-galactoseamine (galnac)
PDB Compounds: (A:) helix pomatia agglutinin

SCOP Domain Sequences for d2ccva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ccva1 b.154.1.1 (A:1-99) Agglutinin HPA {Roman snail (Helix pomatia) [TaxId: 6536]}
rvqsgkidcgddagwakvpsddpgrdntrelaknitfaspycrppvvllsitqldveqsq
nlrviarlysvspsgfkascytwhntkvysmsiswisie

SCOP Domain Coordinates for d2ccva1:

Click to download the PDB-style file with coordinates for d2ccva1.
(The format of our PDB-style files is described here.)

Timeline for d2ccva1: