Lineage for d2ccsa_ (2ccs A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537076Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2537077Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2537078Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)
  6. 2537320Protein automated matches [190229] (11 species)
    not a true protein
  7. 2537333Species Human (Homo sapiens) [TaxId:9606] [187292] (136 PDB entries)
  8. 2537416Domain d2ccsa_: 2ccs A: [130255]
    automated match to d1osfa_
    complexed with 4bh

Details for d2ccsa_

PDB Entry: 2ccs (more details), 1.79 Å

PDB Description: human hsp90 with 4-chloro-6-(4-piperazin-1-yl-1h-pyrazol-3-yl)- benzene-1,2-diol
PDB Compounds: (A:) heat shock protein hsp-90 alpha

SCOPe Domain Sequences for d2ccsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ccsa_ d.122.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryetltdpskldsgke
lhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfg
vgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqt
eyleerrikeivkkhsqfigypitlfvek

SCOPe Domain Coordinates for d2ccsa_:

Click to download the PDB-style file with coordinates for d2ccsa_.
(The format of our PDB-style files is described here.)

Timeline for d2ccsa_: