Lineage for d2ccrb_ (2ccr B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2830557Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2831217Protein automated matches [190057] (28 species)
    not a true protein
  7. 2831234Species Bacillus licheniformis [TaxId:1402] [187025] (3 PDB entries)
  8. 2831235Domain d2ccrb_: 2ccr B: [130254]
    Other proteins in same PDB: d2ccra1
    automated match to d1ur0b_
    complexed with ca, pge

Details for d2ccrb_

PDB Entry: 2ccr (more details), 2.3 Å

PDB Description: structure of beta-1,4-galactanase
PDB Compounds: (B:) yvfo

SCOPe Domain Sequences for d2ccrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ccrb_ c.1.8.3 (B:) automated matches {Bacillus licheniformis [TaxId: 1402]}
glyvekvsglrkdfikgvdvssiialeesgvafynesgkkqdifktlkeagvnyvrvriw
ndpydangngygggnndlekaiqigkratangmklladfhysdfwadpakqkapkawanl
nfedkktalyqytkqslkamkaagidigmvqvgnetngglagetdwakmsqlfnagsqav
retdsnilvalhftnpetsgryawiaetlhrhhvdydvfassyypfwhgtlknltsvlts
vadtygkkvmvaetsytytaedgdghgntapkngqtlnnpvtvqgqanavrdviqavsdv
geagigvfywepawipvgpahrleknkalwetygsgwatsyaaeydpedagkwfggsavd
nqalfdfkgrplpslhvfqyvdtgtpfk

SCOPe Domain Coordinates for d2ccrb_:

Click to download the PDB-style file with coordinates for d2ccrb_.
(The format of our PDB-style files is described here.)

Timeline for d2ccrb_: