Lineage for d2ccra1 (2ccr A:11-397)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2093694Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2093722Protein Beta-1,4-galactanase [89469] (4 species)
  7. 2093723Species Bacillus licheniformis [TaxId:1402] [117367] (4 PDB entries)
    Uniprot Q65CX5 36-422 ! Uniprot Q65CX5 28-424
  8. 2093726Domain d2ccra1: 2ccr A:11-397 [130253]
    Other proteins in same PDB: d2ccrb_
    complexed with b2g, b4g, ca, pge

Details for d2ccra1

PDB Entry: 2ccr (more details), 2.3 Å

PDB Description: structure of beta-1,4-galactanase
PDB Compounds: (A:) yvfo

SCOPe Domain Sequences for d2ccra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ccra1 c.1.8.3 (A:11-397) Beta-1,4-galactanase {Bacillus licheniformis [TaxId: 1402]}
glyvekvsglrkdfikgvdvssiialeesgvafynesgkkqdifktlkeagvnyvrvriw
ndpydangngygggnndlekaiqigkratangmklladfhysdfwadpakqkapkawanl
nfedkktalyqytkqslkamkaagidigmvqvgnetngglagetdwakmsqlfnagsqav
retdsnilvalhftnpetsgryawiaetlhrhhvdydvfassyypfwhgtlknltsvlts
vadtygkkvmvaetsytytaedgdghgntapkngqtlnnpvtvqgqanavrdviqavsdv
geagigvfywepawipvgpahrleknkalwetygsgwatsyaaeydpedagkwfggsavd
nqalfdfkgrplpslhvfqyvdtgtpf

SCOPe Domain Coordinates for d2ccra1:

Click to download the PDB-style file with coordinates for d2ccra1.
(The format of our PDB-style files is described here.)

Timeline for d2ccra1: