Lineage for d2ccqa1 (2ccq A:11-109)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 741735Fold d.314: PUG domain-like [143502] (1 superfamily)
    alpha(2)-beta-alpha(2)-beta(2)-alpha; cluster of helices with a small antiparallel beta-sheet on one side; order 132; topological similarity to the fold of an extended R3H domain (PDB 1whr)
  4. 741736Superfamily d.314.1: PUG domain-like [143503] (1 family) (S)
  5. 741737Family d.314.1.1: PUG domain [143504] (1 protein)
    SMART 00580; domain in protein kinases, N-glycanases and other nuclear proteins
  6. 741738Protein N-glycanase 1, N-terminal domain [143505] (2 species)
  7. 741739Species Human (Homo sapiens) [TaxId:9606] [143507] (2 PDB entries)
  8. 741740Domain d2ccqa1: 2ccq A:11-109 [130252]
    complexed with gol

Details for d2ccqa1

PDB Entry: 2ccq (more details), 1.6 Å

PDB Description: the pub domain functions as a p97 binding module in human peptide n- glycanase.
PDB Compounds: (A:) peptide n-glycanase homolog

SCOP Domain Sequences for d2ccqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ccqa1 d.314.1.1 (A:11-109) N-glycanase 1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
gsaspavaelcqntpetfleaskllltyadnilrnpndekyrsirigntafstrllpvrg
aveclfemgfeegethlifpkkasveqlqkirdliaier

SCOP Domain Coordinates for d2ccqa1:

Click to download the PDB-style file with coordinates for d2ccqa1.
(The format of our PDB-style files is described here.)

Timeline for d2ccqa1: