SCOPe 2.05: Domain d2cclc_: 2ccl C:

Lineage for d2cclc_ (2ccl C:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families)

5. Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins)
   Pfam PF00963

6. Protein automated matches [190248] (6 species)
   not a true protein

7. Species Clostridium thermocellum [TaxId:1515] [187024] (1 PDB entry)

8. Domain d2cclc_: 2ccl C: [130249]
   Other proteins in same PDB: d2cclb1, d2ccld_
   automated match to d1ohza_
   complexed with ca, po4; mutant

Details for d2cclc_

PDB Entry: 2ccl, 2.03 Å

PDB Description: the s45a, t46a mutant of the type i cohesin-dockerin complex from the cellulosome of clostridium thermocellum

PDB Compounds: (C:) cellulosomal scaffolding protein a

SCOPe Domain Sequences for d2cclc_:

Sequence; same for both SEQRES and ATOM records:

>d2cclc_ b.2.2.2 (C:) automated matches {Clostridium thermocellum [TaxId: 1515]}
gvvveigkvtgsvgttveipvyfrgvpskgiancdfvfrydpnvleiigidpgdiivdpn
ptksfdtaiypdrkiivflfaedsgtgayaitkdgvfakiratvkssapgyitfdevggf
adndlveqkvsfidggvnvgnatptkleh

Timeline for d2cclc_:

• d2cclc_ first appeared in SCOP 1.73, called d2cclc1
  
• d2cclc_ appears in SCOPe 2.04
  
• d2cclc_ is called d2cclc2 in SCOPe 2.06
  
• d2cclc_ appears in the current release, SCOPe 2.08, called d2cclc2