Class b: All beta proteins [48724] (174 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) |
Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins) Pfam PF00963 |
Protein automated matches [190248] (5 species) not a true protein |
Species Clostridium thermocellum [TaxId:1515] [187024] (1 PDB entry) |
Domain d2cclc_: 2ccl C: [130249] Other proteins in same PDB: d2cclb1, d2ccld_ automated match to d1ohza_ complexed with ca, po4; mutant |
PDB Entry: 2ccl (more details), 2.03 Å
SCOPe Domain Sequences for d2cclc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cclc_ b.2.2.2 (C:) automated matches {Clostridium thermocellum [TaxId: 1515]} gvvveigkvtgsvgttveipvyfrgvpskgiancdfvfrydpnvleiigidpgdiivdpn ptksfdtaiypdrkiivflfaedsgtgayaitkdgvfakiratvkssapgyitfdevggf adndlveqkvsfidggvnvgnatptkleh
Timeline for d2cclc_: