SCOP 1.75: Domain d2cclc1: 2ccl C:5-144

Lineage for d2cclc1 (2ccl C:5-144)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.2: Carbohydrate-binding domain [49384] (3 families)

5. Family b.2.2.2: Cellulose-binding domain family III [49390] (8 proteins)
   Pfam PF00963

6. Protein Cohesin domain [49396] (2 species)

7. Species Clostridium thermocellum, cellulosome, various modules [TaxId:1515] [49397] (5 PDB entries)

8. Domain d2cclc1: 2ccl C:5-144 [130249]
   Other proteins in same PDB: d2cclb1, d2ccld1
   automatically matched to d1ohza_
   complexed with ca, po4; mutant

Details for d2cclc1

PDB Entry: 2ccl, 2.03 Å

PDB Description: the s45a, t46a mutant of the type i cohesin-dockerin complex from the cellulosome of clostridium thermocellum

PDB Compounds: (C:) cellulosomal scaffolding protein a

SCOP Domain Sequences for d2cclc1:

Sequence; same for both SEQRES and ATOM records:

>d2cclc1 b.2.2.2 (C:5-144) Cohesin domain {Clostridium thermocellum, cellulosome, various modules [TaxId: 1515]}
gvvveigkvtgsvgttveipvyfrgvpskgiancdfvfrydpnvleiigidpgdiivdpn
ptksfdtaiypdrkiivflfaedsgtgayaitkdgvfakiratvkssapgyitfdevggf
adndlveqkvsfidggvnvg

Timeline for d2cclc1:

• d2cclc1 first appeared in SCOP 1.73
  
• d2cclc1 is called d2cclc_ in SCOPe 2.01
  
• d2cclc1 appears in the current release, SCOPe 2.08, called d2cclc2