Lineage for d2cclc1 (2ccl C:5-144)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 659309Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 659323Superfamily b.2.2: Carbohydrate-binding domain [49384] (3 families) (S)
  5. 659337Family b.2.2.2: Cellulose-binding domain family III [49390] (6 proteins)
    Pfam PF00963
  6. 659351Protein Cohesin domain [49396] (1 species)
  7. 659352Species Clostridium thermocellum, cellulosome, various modules [TaxId:1515] [49397] (5 PDB entries)
  8. 659356Domain d2cclc1: 2ccl C:5-144 [130249]
    automatically matched to d1ohza_
    complexed with ca, po4; mutant

Details for d2cclc1

PDB Entry: 2ccl (more details), 2.03 Å

PDB Description: the s45a, t46a mutant of the type i cohesin-dockerin complex from the cellulosome of clostridium thermocellum
PDB Compounds: (C:) cellulosomal scaffolding protein a

SCOP Domain Sequences for d2cclc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cclc1 b.2.2.2 (C:5-144) Cohesin domain {Clostridium thermocellum, cellulosome, various modules [TaxId: 1515]}
gvvveigkvtgsvgttveipvyfrgvpskgiancdfvfrydpnvleiigidpgdiivdpn
ptksfdtaiypdrkiivflfaedsgtgayaitkdgvfakiratvkssapgyitfdevggf
adndlveqkvsfidggvnvg

SCOP Domain Coordinates for d2cclc1:

Click to download the PDB-style file with coordinates for d2cclc1.
(The format of our PDB-style files is described here.)

Timeline for d2cclc1: