SCOPe 2.02: Domain d2ccla_: 2ccl A:

Lineage for d2ccla_ (2ccl A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families)

5. Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins)
   Pfam PF00963

6. Protein automated matches [190248] (5 species)
   not a true protein

7. Species Clostridium thermocellum [TaxId:1515] [187024] (1 PDB entry)

8. Domain d2ccla_: 2ccl A: [130248]
   Other proteins in same PDB: d2cclb1, d2ccld_
   automated match to d1ohza_
   complexed with ca, po4; mutant

Details for d2ccla_

PDB Entry: 2ccl, 2.03 Å

PDB Description: the s45a, t46a mutant of the type i cohesin-dockerin complex from the cellulosome of clostridium thermocellum

PDB Compounds: (A:) cellulosomal scaffolding protein a

SCOPe Domain Sequences for d2ccla_:

Sequence; same for both SEQRES and ATOM records:

>d2ccla_ b.2.2.2 (A:) automated matches {Clostridium thermocellum [TaxId: 1515]}
gvvveigkvtgsvgttveipvyfrgvpskgiancdfvfrydpnvleiigidpgdiivdpn
ptksfdtaiypdrkiivflfaedsgtgayaitkdgvfakiratvkssapgyitfdevggf
adndlveqkvsfidggvnvgnatptkleh

Timeline for d2ccla_:

• d2ccla_ first appeared in SCOP 1.73, called d2ccla1
  
• d2ccla_ appears in SCOPe 2.01
  
• d2ccla_ appears in SCOPe 2.03
  
• d2ccla_ appears in the current release, SCOPe 2.08, called d2ccla2