![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) ![]() |
![]() | Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins) Pfam PF00963 |
![]() | Protein automated matches [190248] (5 species) not a true protein |
![]() | Species Clostridium thermocellum [TaxId:1515] [187024] (1 PDB entry) |
![]() | Domain d2ccla_: 2ccl A: [130248] Other proteins in same PDB: d2cclb1, d2ccld_ automated match to d1ohza_ complexed with ca, po4; mutant |
PDB Entry: 2ccl (more details), 2.03 Å
SCOPe Domain Sequences for d2ccla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ccla_ b.2.2.2 (A:) automated matches {Clostridium thermocellum [TaxId: 1515]} gvvveigkvtgsvgttveipvyfrgvpskgiancdfvfrydpnvleiigidpgdiivdpn ptksfdtaiypdrkiivflfaedsgtgayaitkdgvfakiratvkssapgyitfdevggf adndlveqkvsfidggvnvgnatptkleh
Timeline for d2ccla_: