SCOP 1.73: Domain d2ccla1: 2ccl A:5-144

Lineage for d2ccla1 (2ccl A:5-144)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.2: Carbohydrate-binding domain [49384] (3 families)

5. Family b.2.2.2: Cellulose-binding domain family III [49390] (6 proteins)
   Pfam PF00963

6. Protein Cohesin domain [49396] (1 species)

7. Species Clostridium thermocellum, cellulosome, various modules [TaxId:1515] [49397] (5 PDB entries)

8. Domain d2ccla1: 2ccl A:5-144 [130248]
   automatically matched to d1ohza_
   complexed with ca, po4; mutant

Details for d2ccla1

PDB Entry: 2ccl, 2.03 Å

PDB Description: the s45a, t46a mutant of the type i cohesin-dockerin complex from the cellulosome of clostridium thermocellum

PDB Compounds: (A:) cellulosomal scaffolding protein a

SCOP Domain Sequences for d2ccla1:

Sequence; same for both SEQRES and ATOM records:

>d2ccla1 b.2.2.2 (A:5-144) Cohesin domain {Clostridium thermocellum, cellulosome, various modules [TaxId: 1515]}
gvvveigkvtgsvgttveipvyfrgvpskgiancdfvfrydpnvleiigidpgdiivdpn
ptksfdtaiypdrkiivflfaedsgtgayaitkdgvfakiratvkssapgyitfdevggf
adndlveqkvsfidggvnvg

Timeline for d2ccla1:

• d2ccla1 is new in SCOP 1.73
  
• d2ccla1 appears in SCOP 1.75
  
• d2ccla1 appears in the current release, SCOPe 2.08, called d2ccla2