SCOPe 2.08: Domain d2ccid1: 2cci D:181-308

Lineage for d2ccid1 (2cci D:181-308)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47957] (89 PDB entries)
   Uniprot P20248 175-432

8. Domain d2ccid1: 2cci D:181-308 [130246]
   Other proteins in same PDB: d2ccia2, d2ccia3, d2ccic2, d2ccic3
   automatically matched to d1vin_1
   protein/DNA complex; complexed with atp, mg

Details for d2ccid1

PDB Entry: 2cci, 2.7 Å

PDB Description: crystal structure of phospho-cdk2 cyclin a in complex with a peptide containing both the substrate and recruitment sites of cdc6

PDB Compounds: (D:) Cyclin-A2

SCOPe Domain Sequences for d2ccid1:

Sequence; same for both SEQRES and ATOM records:

>d2ccid1 a.74.1.1 (D:181-308) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
dihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlavnyid
rflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrmehlvlk
vltfdlaa

Timeline for d2ccid1:

• d2ccid1 first appeared in SCOP 1.73
  
• d2ccid1 appears in SCOPe 2.07