![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein Cyclin-dependent PK, CDK2 [88855] (2 species) CMGC group; CDKs subfamily; serine/threonine kinase |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88856] (124 PDB entries) |
![]() | Domain d2ccic1: 2cci C:1-296 [130245] Other proteins in same PDB: d2ccib1, d2ccib2, d2ccid1, d2ccid2 automatically matched to d1vywa_ complexed with atp, mg; mutant |
PDB Entry: 2cci (more details), 2.7 Å
SCOP Domain Sequences for d2ccic1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ccic1 d.144.1.7 (C:1-296) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} menfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkelnh pnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafchs hrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgckyy stavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykpsf pkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphl
Timeline for d2ccic1: