Class a: All alpha proteins [46456] (290 folds) |
Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (4 families) duplication: consists of two domains of this fold |
Family a.74.1.1: Cyclin [47955] (9 proteins) |
Protein Cyclin A [47956] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [47957] (89 PDB entries) Uniprot P20248 175-432 |
Domain d2cchd2: 2cch D:309-431 [130241] Other proteins in same PDB: d2ccha2, d2ccha3, d2cchc2, d2cchc3 automatically matched to d1vin_2 complexed with atp, gol, so4 |
PDB Entry: 2cch (more details), 1.7 Å
SCOPe Domain Sequences for d2cchd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cchd2 a.74.1.1 (D:309-431) Cyclin A {Human (Homo sapiens) [TaxId: 9606]} ptvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvt gqswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppe tln
Timeline for d2cchd2: